Plant Transcription Factor Database
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc00197.1.g00300.1
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family MYB
Protein Properties Length: 981aa    MW: 107022 Da    PI: 10.1433
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
               Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                                   +g+WT eEd+ lv ++ + G g W+  ar  g++R +k+c++rw++yl 280 KGPWTLEEDLVLVSYISENGEGAWDNLARAAGLNRNGKSCRLRWLNYL 327
                                   79********************************************97 PP

               Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                                   rg+ T+ Ed  + ++    G++ W++Ia++++ gRt++++k++w++ 333 RGSITEAEDAVIRELQSTIGNK-WSKIAKHLP-GRTDNEIKNYWRT 376
                                   7889******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.609275327IPR017930Myb domain
SMARTSM007177.7E-12279329IPR001005SANT/Myb domain
PfamPF002496.4E-12280327IPR001005SANT/Myb domain
CDDcd001672.85E-8282327No hitNo description
PROSITE profilePS5129423.241328382IPR017930Myb domain
SMARTSM007172.1E-12332380IPR001005SANT/Myb domain
PfamPF002493.7E-11333376IPR001005SANT/Myb domain
CDDcd001672.37E-9337376No hitNo description
SuperFamilySSF537562.74E-35676951No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 981 aa     Download sequence    Send to blast
3D Structure ? help Back to Top
PDB ID Evalue Query Start Query End Hit Start Hit End Description
Nucleic Localization Signal ? help Back to Top
No. Start End Sequence
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number